SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434924.CbuK_1957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  434924.CbuK_1957
Domain Number 1 Region: 109-273
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.49e-60
Family NadC C-terminal domain-like 0.000000929
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.77e-30
Family NadC N-terminal domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 434924.CbuK_1957
Sequence length 274
Comment (Coxiella burnetii CbuK Q154)
Sequence
MNKKAIRTAVHAALVEDIGSGDITAELISAETVARASIISCENAIICGIPWVDEVYQAVD
SSVKIQWKVKDGDFVSSNQALALLTGKARSLVTGERTALNWLQTLSGTATTVSRYVEKLK
GTPAHLLDTRKTLPGLRYAQKYAVRCGGGKNHRMGLYDAFLIKENHILSCGSLTQAIQKA
RASHPEKTLEIEVENLNELQEALAAKADIILLDNFDIDTIKKAVKINNSQAKLEISGNVN
LETIHEIAKTGVDYISVGALTKHLRAIDLSMRIY
Download sequence
Identical sequences gi|212219422|ref|YP_002306209.1| WP_005769412.1.18990 WP_005769412.1.25364 WP_005769412.1.35092 WP_005769412.1.513 WP_005769412.1.55037 WP_005769412.1.7296 WP_005769412.1.85884 434924.CbuK_1957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]