SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434924.CbuK_A0029 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  434924.CbuK_A0029
Domain Number - Region: 17-48
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.018
Family CCCH zinc finger 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 434924.CbuK_A0029
Sequence length 100
Comment (Coxiella burnetii CbuK Q154)
Sequence
MTRVQAYLDATTHELLRDCAEKNDCSFSHAEAKSLLLNLMGEERESKNRLENKQQFLRLM
NVLNQVLMCVYDSKKVTIESESAKECLEKIKQSVMESVKD
Download sequence
Identical sequences gi|212208432|ref|YP_002302589.1| gi|212208432|ref|YP_002302589.1|NC_011526 WP_012569528.1.85884 434924.CbuK_A0029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]