SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 435591.BDI_0266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  435591.BDI_0266
Domain Number 1 Region: 66-125
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00000667
Family F1F0 ATP synthase subunit B, membrane domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 435591.BDI_0266
Sequence length 166
Comment (Parabacteroides distasonis ATCC 8503)
Sequence
MSLLTPDSGLLFWMIVSFGIVFVILSKYGFPVIVKAIEQRKAYIDNSLETARQANERLAH
IQAEGEKMLAEAKEKQNAVLKEAFAEKERIIEEARKKAVSEAHLQIEEATRRIREEKEKA
IREVRSEIADLSIAIAEKVMKEKIGRDKEQQQMIDRLLDEVSFSKS
Download sequence
Identical sequences A0A069S0Y7 A0A073I237 A0A078TQX0 A0A0J9DES6 A0A174WKY1 A0A1Q6FBA7 A0A223HJV3 A6L8N7 C7XEF2 D0TIK9 D7IVR9 E1YR90 K6ADG0 K6BC64
WP_005861790.1.12386 WP_005861790.1.27322 WP_005861790.1.29417 WP_005861790.1.34635 WP_005861790.1.38556 WP_005861790.1.40665 WP_005861790.1.47855 WP_005861790.1.52717 WP_005861790.1.56575 WP_005861790.1.61673 WP_005861790.1.72038 WP_005861790.1.725 WP_005861790.1.76859 WP_005861790.1.80225 WP_005861790.1.86952 WP_005861790.1.87144 WP_005861790.1.88798 WP_005861790.1.90444 WP_005861790.1.94048 WP_005861790.1.98975 WP_005861790.1.99689 435591.BDI_0266 gi|150006930|ref|YP_001301673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]