SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 435591.BDI_2364 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  435591.BDI_2364
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Translational machinery components 3.92e-47
Family Ribosomal protein L18 and S11 0.0000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 435591.BDI_2364
Sequence length 114
Comment (Parabacteroides distasonis ATCC 8503)
Sequence
MTTKLERRLKIKAGVRGKISGTTERPRLTVFRSNKQIYAQVIDDTTGKTLAAASSLKLDV
KAPKKEIAAKVGELIAKGAQEAGVQTVVFDRNGYLYHGRIKELADAARNGGLKF
Download sequence
Identical sequences A0A073IFF9 A0A0J9DD87 A0A174THN5 A0A1Q6FLC8 A0A223HRS0 A6LEH5 C7XBK1 D0THT4 D7IRB6 E1Z0H2 K6AJ81 K6ARN9
WP_005853992.1.12386 WP_005853992.1.27322 WP_005853992.1.29417 WP_005853992.1.34635 WP_005853992.1.38556 WP_005853992.1.40665 WP_005853992.1.47855 WP_005853992.1.52717 WP_005853992.1.56575 WP_005853992.1.61673 WP_005853992.1.72038 WP_005853992.1.725 WP_005853992.1.76859 WP_005853992.1.80225 WP_005853992.1.86952 WP_005853992.1.87144 WP_005853992.1.88644 WP_005853992.1.88798 WP_005853992.1.90444 WP_005853992.1.94048 WP_005853992.1.98975 WP_005853992.1.99689 gi|150008968|ref|YP_001303711.1| 435591.BDI_2364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]