SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RRT8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RRT8
Domain Number 1 Region: 4-151,194-212
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 117-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000123
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RRT8
Sequence length 331
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
LNQFCTKCEAGTYQDQEGQTLCKSCPAGKVTATDGAVAEGDCVNCGTGKYAPHAGMGACL
DCPPGRYGPADRTDTSECTTCPPGKYSINYASVSEDDCDVCPAGFYAADGEPVAKTDCED
CPLGSVSINEGSDACTLCGPGSYSDIAPGSGIPAESCKLCPAGSYSAAEGATSVSACTLC
AVGTYNPADGQVDCLRCPAGTYGDEEGLLECKAAPAGYFLPDEGATSAVNLQPCPTGTYS
DIEGLAECLNCVAGTYSNTTAATGCIDCVAGTYSIQGGTSVATCIECAAGTYSDTEASQL
CDPCPAGTYSDVTGLSTCKPCRPGTYGAIQG
Download sequence
Identical sequences A4RRT8
436017.A4RRT8 jgi|Ost9901_3|10107|gwEuk.1.870.1 XP_001415958.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]