SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RTW2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RTW2
Domain Number 1 Region: 355-558
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.92e-40
Family Ribonuclease PH domain 1-like 0.0000232
Further Details:      
 
Domain Number 2 Region: 73-208
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-33
Family Ribonuclease PH domain 1-like 0.00014
Further Details:      
 
Domain Number 3 Region: 513-614
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-22
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 
Domain Number 4 Region: 210-297
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.56e-20
Family Ribonuclease PH domain 2-like 0.0036
Further Details:      
 
Domain Number 5 Region: 682-768
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.48e-17
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 6 Region: 615-704
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RTW2
Sequence length 823
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MDARATSRASAWTRARETRARGERRAASGDGARARANARRRATRATRARGAEHALDALYL
GGRAERDARELVLRIGESEVRLETGKIGLQANGAVFASEGETVLYNTACASRECTGDGSF
VPLTVNYAERFSAAGRTSGGYKKRDGGLRENETLKARLVDRPIRPMMYKGWGYETQVLQW
LMSFDAERSTDALAITAASAALAVSDIPLKKPVVGVRVGLMPGSDEPVVNPTSEQMKQSR
LDLVLAGTDEAVLMIEGFCDFLTTDEMLRAIEKGQEAVAKACKEIDAWAATVAPQKMMQK
LIVQPEGVDEAVAALVEDELKQAIVVPIKQERGAMIGAARERAVEALQDEFQASAVINAC
GKIESRALRDVIRTKGRRQDGRTTSMIRPIACEAGILPRTHGSSLFTRGETQAIGVATLG
GSQDAQRQDDVEAGEDKRFMLHYFFPPSSVGETGRTGGASRREIGHGNLAERALMPILPS
EEDFPFVCKLESTITESNGSSSMATVCAGTLALLDAGVPIKRKVAGIAMGLILGSEAAGG
GDELEPIVLTDILGSEDALGDMDFKVAGDKDGITAFQMDIKVEGITIDVMKTALEEAQKG
LVHILGEMEKCDPAPAGATSKYAPRIASIAVPEKYFGKVIGKGGETIRSIMEKTGAENID
VNKEKEMVFVTGGADADLDAAIRMIEGMIVEPEVGKIYRGCVVKKVVEFGCFVEYLPGLE
GLVHISELDVSRVPNVSDVTSEGAVMDVKIIAVDNRGKTSLSRKEVLLEENPELAAAGSM
SDDSANERNGGGGGRGGGGRGGRGGRAGPKRDSGGPKRDSGGF
Download sequence
Identical sequences A4RTW2
jgi|Ost9901_3|34347|e_gwEuk.3.46.1 XP_001416565.1.19716 436017.A4RTW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]