SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RU01 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RU01
Domain Number 1 Region: 270-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000891
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 3-39
Classification Level Classification E-value
Superfamily SAP domain 0.0000000217
Family SAP domain 0.0027
Further Details:      
 
Domain Number 3 Region: 154-206
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 
Domain Number 4 Region: 380-413
Classification Level Classification E-value
Superfamily WW domain 0.000000193
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RU01
Sequence length 413
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MAGCAKMTVAVLKEELKKRGLDATGLKAALVARLEEAMAGEDDGAAAEAAAPEEEEAKEE
PKEEAGEEEDVRAKAEEMAEKAMAEHAASEKKRERSPEQDDAPPEAKSAKSDGEHAAAPS
SAQGGLTKDGQNLATYEMPDGQVRKDVPTQGNEGRIIGRGGSKIRELQDMFRTRITMNRP
AGLAEVVGMLDHVNDCCDEITRIVEDGNVREAAERAGQPVPGGAYSSYGGGGFGGGGGGF
GGGGFGGGGGGGGGGPFSGHMERVPCEGQEGRIIGRGGENIRRVESQTGTRIKMNRVDNV
AEVYGTPAQCTEAVRMIQEYIHTAPNRGGGGFGGGGFGQQGGYGGGYQQQSFGQQAGYGG
GYQQQAGYGQPAYGAPAGGAPLPHGWEEVNPGNGGPVYYWDTVSNTTTYTRPT
Download sequence
Identical sequences A4RU01
436017.A4RU01 jgi|Ost9901_3|24185|estExt_fgenesh1_pg.C_Chr_30096 XP_001416584.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]