SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RUP6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RUP6
Domain Number 1 Region: 50-118
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000979
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 
Weak hits

Sequence:  436017.A4RUP6
Domain Number - Region: 325-387
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0084
Further Details:      
 
Domain Number - Region: 136-193
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 
Domain Number - Region: 398-419
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00502
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RUP6
Sequence length 473
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MDADVPTYDDEGGRQRSPEPDVDVRDAPVDANAPRDPSSTAPPRPADEVDSTTITTDDAR
FLIGAKGATKRKLMRVSGARLEITAIEGDAAEGQRLDISGSAEARAKAKRYVEWVLRQRV
GKIIVDTSTVMEDVSVMEVPGDCTAYVTGKAGQGLRRIEADNGTLLFFGKPTTDPEDAPE
KLIICGDRKGRRGSELQVMSSIERKIPGTFVDEEKKLKIRFEQPGDGLGDGWGFDVWPFA
NEEELSFAVGREGSTRRKIAKASGCSFEYVGMLGIMTGDRDERARCWDYIRWLLKQQKGT
LGTDISFKDRNDVTVFPCKSGFGGISRIYGTGGATLRLIEQNTGTFCFNIPDPDDEPEKE
LVLIFSHDKGARGRARDAMRDVLNGHRVSANGGNGGQQRCYDFSVGRCRRGNSCKWAHIV
PPGPPGPSRGGDRGRGGDRGRGGPSRGGGPRRDDRKPYSRLNDTWGAMADRLG
Download sequence
Identical sequences A4RUP6
jgi|Ost9901_3|30694|eugene.0300010370 436017.A4RUP6 XP_001416994.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]