SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RV12 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RV12
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.16e-25
Family Calponin-homology domain, CH-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RV12
Sequence length 330
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MGRLELVAWLNRALRSDYASVQECGDGVAYAQLLDAMHPGKVPLHRFDFNARFVGDNERN
VRVLAQTMRALGTRVDVDFDALAKGKFTENNNLLRWFHAYVAKNGSAALEEYDAYAARVE
AQRVKAHASVRRRGEGATPLNRPGDGRASVSERETMSERLVPNELSAVSENKRRTPAATP
TEDADASFEFAPATADARAPATPRALSFLDTPVARTKLDLTDGSTTTTTTTTTTNAETTN
AADDAAKPFARARSLDRWAAKARAKLHADAASELNPASDPAPTAPGPSDPSPFVETVEEE
TSCCGCVRKRRVVRERASQPPPPARALSQR
Download sequence
Identical sequences A4RV12
436017.A4RV12 XP_001417057.1.19716 jgi|Ost9901_3|30811|eugene.0300010487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]