SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RVF2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RVF2
Domain Number 1 Region: 373-439
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 2 Region: 307-369
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000555
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RVF2
Sequence length 493
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MPTATTTTASATDGTAAKRREGAKTTKKTTGKATTTGQATTARRDDDATTTATTTTATAT
ATTTKKKTRNGAKRDGGVGGDAVKTDWANDAMGDDPRVEAKAKANAPAKNGKKTRGKTTA
TAATTTPKKKEANGTTTTTTTTGMVKKARTPRAERGAPRAAAPAAKSATPTRAPAVGPPM
TITRGESVQKWSNSTTRAALRVEASIRDWIRADGGRELARELQEALSCGDGHVTMQVCEE
SGSGALFVGLHCGEAKFAHALQRVHALVEVKLDDCVRIRRRTGVADMLENERMKIQAEID
AGLRCEFTLGYKAMQDLLLDGGDKLNQVKEVCDVERVVVDPRKRTIRIVGADAAEVSRAR
DMLEVAYESIEDVPELALRMIIGKGGAKVNDIQQRTGANIKVDWDKSAVFIRGPPSAVKS
AMILVKSCIKTYEVEHVEVTYDQLDEVRGELARLDMEWGGSPVHYVQGGRGGGRGGGRGG
GRGRRNDRSSTAA
Download sequence
Identical sequences A4RVF2
436017.A4RVF2 jgi|Ost9901_3|24341|estExt_fgenesh1_pg.C_Chr_40020 XP_001417124.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]