SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RZ88 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RZ88
Domain Number 1 Region: 20-160
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-40
Family Dual specificity phosphatase-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RZ88
Sequence length 161
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
RVKALFAALLTARSVKNDSRAVEVTKGVYIGSVGAAKNVEALRELGVTHVLTACGGMPRE
GFYPDDFEYATCAVDDKPDAAIDEHFDRCFDFIRDALARDGKVLVHCFQGKSRSATICAM
YMMRALGMDLDEAMTAIREVRPCAQPNSGFIRALRALERSL
Download sequence
Identical sequences A4RZ88
jgi|Ost9901_3|7942|gwEuk.6.506.1 436017.A4RZ88 XP_001418287.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]