SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4S715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4S715
Domain Number 1 Region: 174-257
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 29-98
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 3 Region: 112-166
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000304
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436017.A4S715
Sequence length 321
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MAVNVAKAAPKSARDDEDAGVVGDGANSKKATYCVEHYDMDVKYEGLIIGPGGATIRKLQ
QDIGTSIEVVRGEGKLQIKGSREKIEYARKMLDEFFEQKGSKTVKVKCKARSGLIIGNAG
QTIKALKEQTGCRIEVMRDVEECVITGPGDRVKVAQAIVEKMIADSWEEGADGDITIVEE
VIPCAYKAGAIIGPSGGTIRHIRETTGVAIDIERGADGCKASDQCRIIGTPAQVKKAVEI
VHQLLKEMNQAQLQAAPVVPPMYAYGYGTMPNAYAAVPGIPVNSSQMQQIDPQTAAYYAQ
WQAYYAAQQNTVMPPHPPADG
Download sequence
Identical sequences A4S715
436017.A4S715 XP_001421193.1.19716 jgi|Ost9901_3|27317|eugene.1400010032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]