SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4S770 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4S770
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.87e-54
Family NAD kinase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436017.A4S770
Sequence length 201
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MRLECTLVKAKDKIGSGGTGEFTKKITVLNELLVDRGPSPYLSQIEAYDRGELITTIQAD
GVIVATATGSTAYSVSAGGSMVHPNVPAILMTPICPHTLSFRPVIFPDSVEIELRVAQDA
RCSAWVSFDGRDRCELESGDSVFVRMSQYPIPTINYADQTGDFINSLRRCLRWNERDMQH
AFDASQKEALRKISEAESNNK
Download sequence
Identical sequences A4S770
XP_001421403.1.19716 436017.A4S770 jgi|Ost9901_3|42981|e_gwEuk.14.360.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]