SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4S9M3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4S9M3
Domain Number 1 Region: 172-259
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 22-101
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.79e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436017.A4S9M3
Sequence length 437
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MSLDSPSARAAQGREVIDLSAEMYEDEQPYVEILHIPNNKVGLVIGRDGRHVGFVQNRTG
TRISIARDSWDGSRRRVEIEGPPERCREAATMIQRLIASADDRDREISEGAIRALFEGLE
VAETAVMAANVVASQRAREELADDADAQFDDSSADFDGRGMPGAPRGAPPSARQGPATAT
MTIPHTKVGMIIGRGGDNVKYIQQQTHARIQIQTDAETPEGAPNRMVYLRGPVEACRHAA
RLINDMCIGRVLIHAPVPHHGALMTPAMPGEPLDRGDRGAGKAVASGGGGAPPYPSSRSA
YGPMQIDYSAIPAMYPPPYFGQPYTGLYNVGAYPHEMMPYWNQYATYYGQPPMMTPYDLG
GKEGQTVYYEQPATPPFRYGEEIERGQGESEGEVEVEGEGVAEPQPRADSPSSPESKDAV
SDSTRSPTTPKQHQRQT
Download sequence
Identical sequences A4S9M3
jgi|Ost9901_3|28250|eugene.1700010043 436017.A4S9M3 XP_001422091.1.19716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]