SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436114.SYO3AOP1_1756 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436114.SYO3AOP1_1756
Domain Number 1 Region: 19-96,145-173,262-301
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.57e-24
Family NodB-like polysaccharide deacetylase 0.015
Further Details:      
 
Weak hits

Sequence:  436114.SYO3AOP1_1756
Domain Number - Region: 184-285
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0235
Family Gametocyte protein Pfg27 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436114.SYO3AOP1_1756
Sequence length 351
Comment (Sulfurihydrogenibium YO3AOP1)
Sequence
MAEVFVIYYHKILPRFGFDVFYKTFDLEMKILKSFYNVVSLDEVEQYIKEDKRPNKPTVA
ITFDDGYVDNFVYAYPILKKYNLKATIFPIASRILQKDFVRPTLFDYWQGKVSFKELHQP
KTMAQANLEYLKHGVKDTKDWDFLTVAELNKMKDVFDVGGHAYLHSRVFYDEEIIDFYDG
KNGHWSFYYAYGEEPKIGFPILKSQNNLAVERSYIKKEVKDYVKSLDESYFKQKDWKIRL
KKELLKKFDKIVDKEPMQERKERVIKELQESKSMLESMINQKIRHFAYPFGHYDDLLVEL
VGLFFETAFTTEKDVIKSKTNLHKIPRFGIPKDISSFIAVLGKAKIKGAKS
Download sequence
Identical sequences B2V7C2
436114.SYO3AOP1_1756 gi|188997656|ref|YP_001931907.1| WP_012460408.1.9181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]