SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436308.Nmar_0431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436308.Nmar_0431
Domain Number 1 Region: 54-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-18
Family Cold shock DNA-binding domain-like 0.00042
Further Details:      
 
Domain Number 2 Region: 144-220
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.33e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00049
Further Details:      
 
Domain Number 3 Region: 2-54
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000000785
Family ECR1 N-terminal domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436308.Nmar_0431
Sequence length 226
Comment (Nitrosopumilus maritimus SCM1)
Sequence
MADKRKYVIPGDVVTTGPFRPEQNTVLEGNKIISTTIGISEIYDDSVRVIPLTGKYIPKI
NDLVIGKVNSHTSLSWELDINSCYVGFLPAQDVFGRDFSAHADELATKLRTGDLVAARIA
NFDRTRDPLVSISDRDLGKIDSGVLMEISPSKVPRLIGKKGSMIQMIEEATDAAVTIGQN
GWVVVSCESPEGLLKAKKAIQMVNEQAHVANLTDQVKEMLDKKGES
Download sequence
Identical sequences A9A5C8
436308.Nmar_0431 gi|161527939|ref|YP_001581765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]