SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436308.Nmar_0704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  436308.Nmar_0704
Domain Number - Region: 222-256
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0863
Family Ribosomal protein L11, C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436308.Nmar_0704
Sequence length 266
Comment (Nitrosopumilus maritimus SCM1)
Sequence
MSNLKKQDTIGIIAAIAITIVSVGFAIAGTAPTDMPQKQAQNIEVIGFGGITDAKESIKI
LLESKSIDLDTSNGFIRGNVVYEGFQPQMGLVYLEIFSPTGDKVNKSELQLRDRGNDVYE
AEFTQYFDKSDFLNNNEKTGQYMMRISTEYGMLAKQTPFDVIMSSQEQPKINTVVMESNE
EIGLGGILHEKKIRTGYDIGVMEKDLENTILKKYLTKVLKGYHNGDISKDDVEKLAEFKS
IDCNFTDQTSQNKDVLQLSCEIIPEN
Download sequence
Identical sequences A9A4B1
436308.Nmar_0704 gi|161528212|ref|YP_001582038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]