SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436907.A7TEK8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TEK8
Domain Number 1 Region: 132-251
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.69e-25
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000344
Further Details:      
 
Domain Number 2 Region: 252-298
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000314
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TEK8
Sequence length 494
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MNTEDTRGRTPNKGNAALWGCSSAMNSMKRFNHLPTTINGALTQEQLIAYQTMFRIQEIT
SKLRMNEFQIPERKNRSPSPPPAYDARGRRTNTREQRYKRKLEEERHRLVEIALKLIPHF
VAPEDYKRPTKFQDKYYIPVSQYPDINFVGLLLGPRGNTLKKLQEDSQCKIAIRGRGSVK
EGKNANDLPQGAMNFSDPLHCLIIADTEEKVQKGLKVCENIVVKAVTSPEGQNDLKRGQL
RELAELNGTLREDNRPCQNCGLEGHKKYDCPSKETYASRIICNRCGQSGHVTRDCNADMS
TQNNGYQGKPKRYNMDEYNYEQRDWKRRHIYNNNGYNSNSYENESQEVITSYRSRNTRSA
IPTGYDTSNRQYSTHANMSSSDPLIGMPQHNAVELTNHQYNSYGNSNNNAEINSAAAVSD
SKDQHDAQSQPSRELTPGIPSGISDSYSLAAPPGLTGPPGLGTPPGLDAPPGLDDTNGQN
TLQLPPGLSGPPGL
Download sequence
Identical sequences A7TEK8
XP_001647173.1.22633 tr|A7TEK8|A7TEK8_VANPO 436907.A7TEK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]