SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436907.A7TFC5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TFC5
Domain Number 1 Region: 120-217
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.32e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0063
Further Details:      
 
Weak hits

Sequence:  436907.A7TFC5
Domain Number - Region: 75-134
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0157
Family Gametocyte protein Pfg27 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TFC5
Sequence length 338
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV
TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD
MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL
KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP
KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK
DYVAPMEEEYKSTITKSSKKRSISTSDDSSKSKKSKKE
Download sequence
Identical sequences A7TFC5
436907.A7TFC5 XP_001646797.1.22633 tr|A7TFC5|A7TFC5_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]