SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436907.A7TK28 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TK28
Domain Number 1 Region: 105-252
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.56e-27
Family Calponin-homology domain, CH-domain 0.000097
Further Details:      
 
Domain Number 2 Region: 846-1155
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000192
Family p120GAP domain-like 0.014
Further Details:      
 
Weak hits

Sequence:  436907.A7TK28
Domain Number - Region: 1396-1511
Classification Level Classification E-value
Superfamily RGC domain-like 0.000275
Family RGC domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TK28
Sequence length 1513
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MSAIADSPTRSTNNSFINRYIQNLENEGSPQLKPLSPSKLNSSSNLNLLKSNQSSPIKPT
KLDSQVPKFTTKIDSHSKSVPPLYSSNVNPSAQFDKSTLSKDELKYYELLCRVGEVKCWI
EEVIGQEIEPEIELCAGDALRNGVYLATVAQKINPSLVPTVYPAGKKLEFKHTQNINAFF
TLVDHVGVPNSFRFELQDLYNKKDLPQVFETLNIMITIINKKWPTKTPGLTNLSGQLTFT
KDDLKKCQRTWPRIRDFKSLAVSPTSSPIKKTKVQSGLIEDFNEFQNNKEPVLDETIYKT
PEKKKPVDIKRELTPSISDLQLPSHNTKAENFNESTPKVSYKSPFKSIDYDILTRTPNLE
YSPLKLSSLSYHSPSIARYSTLDTDFYLRRSQNREQGLQFYNTHSYSPTRYSPTRYSPTR
YSKLNYSPNRRQKMTEDEFLDNVIDIQSICRSANLRFDLNIKMRLAKLHEKEVIFFQSLV
RGNEARSKFNKPFKMNSSEISLSELSHLQATIKGIILRENIDRKRIRILRQEKDIIGLQS
MCRACLARANAQAELMDINNVTKPLIKLQAVIKGILFRQFYKTSTLSSLIDKSAITLVQS
VYRGNLKRAEIAKLNHHFNLDCTNSVSRLQAVSKGYLTRNKILNTHKQCLENDETILKLS
TYLRGSRARKDYQMYQINEDSDVIIALQSSIRGVLVRYTLDLVDDVVENSHISVLQARIR
AIMIRSRLDKRKAHFLGNTKSIIKIQSWVRCFNQRIAYKELMSTPNPSLWSVRKFVHLLN
NIGNIENIQNELEKSQAELDSENMRREKMESELRQQLDFSDILDKYKIENNLEQQMSNVH
AASSKYPGYEKLFYLLQVDPTYWKLLYRKDPLFTEDNVYVTFSIVNQRMGEREKVCFTRF
VAELLHQNMVDSHSITNFMNNNTHFWQKLIKLFIQREYPDLISLFLPILEYINDRNIDFT
SDPSVIYRLIHGIECTDRSSAIEDDQTKIHFIENLKNVWHAVEMIAEIFTSRIEAIPVEI
RYLCSKIFTFAADQNYDQTSSLRCISKIVVGTLVKEYLVNRRYYGFVDNNYSNIEEKIAI
LMHSLEAVFEMRDFEGYYDPLNQYSAEIKPYLKDMLMQIMVGPEYEQESERLIYEDMLSV
RPRLEILSEKVIQITNKFQEYLKYIEPDDMIVDILKQCSDDKSIPRTGRVTLELNPASYR
FLQNDDKMKRIYDQVKRIFMYMMQVEDVDTNLYDLAVSTVLDEDEPSFSTLLNDNPRIKE
DPILKKLESPLYFSLKMLALRNIHELENIGMLNPADNQMQSILNDIANNIKFPIFITQSV
EEELDITRYTVHELAAINKQLNSDVTLLKRSINNIIEKFRVSKDYTVVHKGALGNLKDAY
KKVHSKGGDNIQGLKFKWSTKQLYEKGVVKNIEGEKLGELTVKVFGSSGPKFPDIYFKIF
TSDGGKFGIQISDKRKGPSKRYSHLVDTFDFFDLLNTQVGKKVSTWYLFNGKITFSTSKL
LELLSANFFNKHN
Download sequence
Identical sequences A7TK28
tr|A7TK28|A7TK28_VANPO 436907.A7TK28 XP_001645232.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]