SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436907.A7TNF5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TNF5
Domain Number 1 Region: 60-153
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.57e-22
Family Cold shock DNA-binding domain-like 0.0000354
Further Details:      
 
Domain Number 2 Region: 150-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.03e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TNF5
Sequence length 237
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MSVLVLPGDNVEVDAGKPVSLGPGMYCDPKTQMVLPVNAGVLNRTDNKRGQTLYVDYDSK
RYIPATGDFVIGVITGAFADSYRVSLSSFSTPVSLSYMAFPNASKKNRPTLKIGDLVYAR
VCSSEKELEAEIECMDSTTGQDAGFGLLDEGMVAEVSLGFARQLLYNNDFPLLKLLAKHA
QFEIAIGLNGKIWLKSNDIKNTLACYKSILDCSGKQIGEFNEIVKKNFNQFTNTVEE
Download sequence
Identical sequences A7TNF5
XP_001644066.1.22633 436907.A7TNF5 tr|A7TNF5|A7TNF5_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]