SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436907.A7TRA1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TRA1
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.15e-39
Family Calponin-homology domain, CH-domain 0.0000281
Further Details:      
 
Domain Number 2 Region: 201-278
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-16
Family EB1 dimerisation domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TRA1
Sequence length 327
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MSGIGESRTELLNWLNELLQLNYRKVEECGTGAAYCQIMDSIYGDIPMPRVKFTATAEYE
YQTNYKILQSCFQRHRIEKTVYVDKLIKCKFQDNLEFLQWIKKFWVQNKDESPYDAQARR
KYRPPTGNGSTTGSTPGVVKRKTSTVTGSNLSSNTYNSNYSSSGNLRDNSIRSASYGGVR
KASNEQLLALQAELSQSHSKVTSLNKEITTYREAMDIMERERDFYFGKLRDIEILVQSTQ
DLIKEGVYNTTTGSDTNELNKFLGKVQHILYATEEGFEVNNVQHDSNGQHTKELNIRNTH
VINEDISNKTSITSQPTDNLIIDEETF
Download sequence
Identical sequences A7TRA1
XP_001643055.1.22633 436907.A7TRA1 tr|A7TRA1|A7TRA1_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]