SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436907.A7TS41 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TS41
Domain Number 1 Region: 196-238,278-361
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.09e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 102-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-25
Family Cold shock DNA-binding domain-like 0.0000498
Further Details:      
 
Domain Number 3 Region: 53-103
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000000366
Family ECR1 N-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TS41
Sequence length 365
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MSEVISVVKRRGGFQYPSIVDETNDIDTSDEDIEMEDVEKPAGDKKTDAAEGEIVTPGEL
VTDDPIWMRGHGTYFLDNMTYSSVAGTISRVNRLLSVIPLRGRYSPETGDHVIGRITEVG
NKRWKVDIDGKQNAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDG
SASLHTRSLKYGKLRNGLFLQVPSSLIIRSKNHTHNLPGNVTVLLGVNGYIWLRKTSQMD
QARDLPPGGSTGGYPSNSGPTGAKSLNPSSNMSITRLEEESSWQIYSDENDPTITNSIRQ
TISRYANVIRALAYCEIGITQERIVSAYEASMAYPNIGSLIERDVMESIGNDVINGEKMR
GNGGN
Download sequence
Identical sequences A7TS41
436907.A7TS41 XP_001642785.1.22633 tr|A7TS41|A7TS41_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]