SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436907.A7TSS8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436907.A7TSS8
Domain Number 1 Region: 788-893
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 2 Region: 161-258
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 3 Region: 709-776
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 4 Region: 1153-1216
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 5 Region: 632-712
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 941-1028
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000095
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Weak hits

Sequence:  436907.A7TSS8
Domain Number - Region: 315-388
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436907.A7TSS8
Sequence length 1218
Comment (Vanderwaltozyma polyspora DSM 70294)
Sequence
MSLSFENKEDSPAAAAASSTSSSIEETATLTGTTVDDSVDETSTSTVSSTVTPAKLPSLK
DLPQLGSSYAFTNTKVNWGPNVKPSVQPTANSVSPSPSPSLSNSKPMRSNVIQEAFTLDL
QTQLSMTRPEFAKIIQSVKQNHKVSLESTLSKSSRTFLVSGKREDVQAARRELVKKMTKP
ITQVFEIPSRCRAAIIGSGGKTIREISNEFEVKIDVAKDIKEGSYDKELDDNYAEVTLHG
DVASVNLAKNRILDIVKEETKNSVVKFNVDNEKILGYVDLSEFINRNDDSIKIQYFERSG
DIIISGLRELVGSARKDIESYLSKLSNNLVEESVKIPAKFQLLINANEINDKFNVTVVFP
TDSSSEFVTFIGQQDKVSEAIAYARSSSKDFAVDSLDISKSHGKNLDHARQLSLFFKKYD
SFKSINQEYPEIQIHLPAPAIMNAANDVTFTITARSSQVSDIKSVRKEIINLVNNITPLD
TLTVDDLDYDLFHKDIKHILLGEAENAGFIQMGDYFSGNDSLVLFALSSNDDFKPSTEEV
LETLKKVNSSLDPLRQKQNSLESVTVDFESDSQDALLAKGKPTLELLLEDVAQEDGNVQI
KLHKPNKDQLLVRGNEKAVKIVKKALASITESPSDKSKLAFEIPSNTVSRLVGNKGSNLQ
QIREKFDCSVNVPNVSENSSKDTTVEITLTGLSYNLDHAKHYIMAEAKKWADIVTKEMII
PAKFHRNMIGSQGLYRNRLQDKYNVRIIFPKSGDIVTVRGPSRGVNKAVDEMKALLDFEI
ENGHKTIIKVPTDHVARVIGKSGETINDIRADFGVELDFLQNANDEEAAKNGFVELEITG
TRAGIKDATARVESIVSEASDFITETLDVDRKYHKFIVGAGGQNLREIISKAGGDEIRNK
SVQLPNNDSEETKITVQGPKKFVQTVVKQIQQTVSDIDNRVTKELDIPTERQGALIGPGG
IIRHQLESEFNISLDVPNKGEVGKVKISGLSENIDKAEKKIMNEIIRDNFDVELQVPASV
HEFVSERGAFIQKLRFDQYVGIRHGNSNRRANKLSRTELVIPVEKASGAGSDEKIKITIE
EASLPHASEEGTIPWRLSYEPIDSTGLFDDEENKEEKKEEKDVKALKEEAIKKATKLIED
RIALAEKANFVAYIWSSDARKFNKIVGPGGSNVKKIRENTGTIINVPKRSDKVNDIIYVR
GTKEGVEKAAESIVKSLK
Download sequence
Identical sequences A7TSS8
XP_001642533.1.22633 tr|A7TSS8|A7TSS8_VANPO 436907.A7TSS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]