SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 438753.AZC_0063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  438753.AZC_0063
Domain Number 1 Region: 29-176
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-52
Family Ribonuclease PH domain 1-like 0.0000192
Further Details:      
 
Domain Number 2 Region: 328-523
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-50
Family Ribonuclease PH domain 1-like 0.0000101
Further Details:      
 
Domain Number 3 Region: 177-268
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.18e-30
Family Ribonuclease PH domain 2-like 0.00084
Further Details:      
 
Domain Number 4 Region: 485-583
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.75e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 643-728
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.05e-21
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 
Domain Number 6 Region: 271-355
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.36e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0096
Further Details:      
 
Domain Number 7 Region: 587-664
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.16e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 438753.AZC_0063
Sequence length 756
Comment (Azorhizobium caulinodans ORS 571)
Sequence
MLPSAPCGGGAARASRRLAHGSPSSSEKKETFMFDIHREELDWGGRTLVLETGKMARQAD
GAVFASYGDTTVLATVVSAREPKPGQDFFPLTVNYQEKTYAAGRIPGGYFKREGRPSEKE
TLVSRLIDRPIRPLFADGYKNDTQVVVTVLAHDLENDPDVLSMVAASAALTLSGVPFMGP
IGGARVGFVGDEYVLNPTIEELKDSALDLVVAGTSDAVLMVESEAKELSEEVMLGAVMFG
HRHFQPVIEAIIRLAEKAAKEPRPFEPVDHSALEAKIREIAEADLRAAYKIKQKQARYEA
VGAAKSKVKKYFEQLAIDGQEAPKAQDVAEVLKGLEAKIVRWAILDDGIRIDGRDVKTVR
PIVSEVGILPRAHGSALFTRGETQALVVATLGTGEDEQFIDSLEGTYKEHFLLHYNFPPF
SVGETGRMGSPGRREIGHGKLAWRAIHPMLPAKHEFPYTLRVVSEILESNGSSSMATVCG
TSLSLMDAGVPLKSPVAGIAMGLILEGEKFAVLSDILGDEDHLGDMDFKVAGTESGVTAL
QMDIKIAGITEEIMKVALAQAKDGRAHILGEMSKALTSARAELGEHAPRIEVMKIAVDKI
REVIGSGGKVIREIVEKTGAKINIEDDGTIKIASASGDSIKAAINWIKSIASEPEVGAIY
DGTVVKVVDFGAFVNFFGSKDGLVHISQLSKERVAKSSDVVKEGDKVKVKLVGFDERGKT
RLSMKAVDQTTGEDLEAKAKSEKDAAKEGDEAGAAE
Download sequence
Identical sequences 438753.AZC_0063 gi|158421687|ref|YP_001522979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]