SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 438753.AZC_1717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  438753.AZC_1717
Domain Number 1 Region: 18-118
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000000000085
Family TolA 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 438753.AZC_1717
Sequence length 139
Comment (Azorhizobium caulinodans ORS 571)
Sequence
MLRFLLSALVLGVCVTAAQAEDLPQTVAQWRQAAWTRLAQLSNIPPEVVDKPGTYQAEVT
IIVRRDGSVARSELAQSCGKDELDENALRLAHMASPLPPLPPDMPFATMSVTLPVVYAYP
PRPPRTVRELRRLRKDISR
Download sequence
Identical sequences A8I4D0
gi|158423341|ref|YP_001524633.1| WP_012170245.1.27236 438753.AZC_1717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]