SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 439235.Dalk_4743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439235.Dalk_4743
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-47
Family Ribonuclease PH domain 1-like 0.0000311
Further Details:      
 
Domain Number 2 Region: 295-466
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-44
Family Ribonuclease PH domain 1-like 0.0000274
Further Details:      
 
Domain Number 3 Region: 448-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.83e-27
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 4 Region: 137-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.81e-25
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 5 Region: 606-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.48e-21
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 
Domain Number 6 Region: 225-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 9.29e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.002
Further Details:      
 
Domain Number 7 Region: 545-618
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000335
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 439235.Dalk_4743
Sequence length 712
Comment (Desulfatibacillum alkenivorans AK 01)
Sequence
MEVTLERNLGDKPLRIQTGKLAKQASGSVVVSYGETITLVTVVGSQELRPGIDFVPLSVE
YQEKVYAAGRIPGNYFRREIGRPSEKETLTARLIDRPIRPLFPKTWRYETQVIATVLSMD
QENDPDMLSMVGASAALCISDLPFFTPIACVRVGRIDGELVANPTISQQENCDLNIIVAG
SRDGVVMVEGGGQFISEEEMLDAIYFGQESLEPLLEMQEELMEKAGVPKRSADPVEKDEY
LAAKVAELADPEIKKALEINDKLERQDAIRDVKKTVMEGLGEEYEDRGKEVSEFIHDRTR
VIMRAMVLDEGRRIGGRRFDEVRPITCEVGILPRTHGSALFTRGETQSLGILTLGSSGDE
QRVETLYGDETRPFMLHYNFPPYSVREVKRISGPSRRDIGHGGLSTRAIKEVLPSKEDFD
YTIRIVSEILESNGSSSMATVCSASLALMDGGVPITNPVSGIAMGLMAEGDKIVVLSDIL
GDEDHMGDMDFKVAGTKDGITSVQMDIKISSLTREIMEKALAQARVGRLHILEKMLTTIS
ESREEMSPYAPKVFTIQIHPDKIRDIIGPGGKVIRAIQAETGTRVDVDDSGLVKVSAVNL
EEGEAALQMIKDITAVPEVGAVYEGTVVKIMDFGAFVAILPGTEGLCHISQLDTKHVKKV
SDVVKEGEKIKVKVLELTKDGKIRLSRKALLEEENGKSGPENGAPQRDKNRH
Download sequence
Identical sequences B8FCZ0
gi|218782571|ref|YP_002433889.1| WP_015949460.1.12191 439235.Dalk_4743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]