SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 439386.YG5714_0174 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439386.YG5714_0174
Domain Number 1 Region: 75-159
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.79e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 439386.YG5714_0174
Sequence length 186
Comment (Sulfolobus islandicus Y G 57 14)
Sequence
MFTTVEDEKLEVVKKIIEKLEQFTDTKIMYDERTKTFNILPKGQNQYEALKAVSVIRAIG
LGFDEQSAFRLLSDEYILDVIDLKTLIGSNPDAIRRVKGRIIGEGGKAKRIIQEYTGVDI
SIYGHYIGIIGPYDQVQIARKAIELLIDGKEHSSVYKFLDKAEKDLIIYKTSKLGRKGIN
EIKSNR
Download sequence
Identical sequences C3N8M7 D2PEL8 F0NJ34 M9U648
gi|479324592|ref|YP_007864640.1| gi|385772196|ref|YP_005644762.1| 439386.YG5714_0174 gi|284996577|ref|YP_003418344.1| gi|229577991|ref|YP_002836389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]