SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 43989.cce_0917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  43989.cce_0917
Domain Number 1 Region: 10-168
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 4.29e-31
Family Hypothetical protein TT1808 (TTHA1514) 0.02
Further Details:      
 
Weak hits

Sequence:  43989.cce_0917
Domain Number - Region: 185-226
Classification Level Classification E-value
Superfamily Prefoldin 0.0204
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 43989.cce_0917
Sequence length 231
Comment (Cyanothece ATCC 51142)
Sequence
MVESVARANQSNITYPERDGNSMSDNTKQFRWIVVIKENLELLFADNPNIFVAGDLLWYP
IKGDNKTRQAPDVMIVFGRPKGDRGSYRQWVENNVTPQVVFEILSPGNRLLEMAKKFKFY
EHHGVEEYYIYDPDKIDLQGWLRKNGELTVIEEIDGWVSPRLGIKFELTTETLEIFRPDG
DKFLTFVELGKLREAERKRAKELQKQLEQEQEQRKRLEDKLRELGIDINDV
Download sequence
Identical sequences B1WST8
gi|172035833|ref|YP_001802334.1| WP_009546149.1.18909 WP_009546149.1.94124 43989.cce_0917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]