SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 43989.cce_4410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  43989.cce_4410
Domain Number - Region: 4-48
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.000379
Family Alpha-macroglobulin receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 43989.cce_4410
Sequence length 57
Comment (Cyanothece ATCC 51142)
Sequence
METITIPKGFRVTPEQFEQLASAKQIARMELTKEGELIITVESVDHSTTRRFSPYCP
Download sequence
Identical sequences B1WTP3
gi|172039323|ref|YP_001805824.1| 43989.cce_4410 WP_009543534.1.18909 WP_009543534.1.94124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]