SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 440085.Mchl_3883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  440085.Mchl_3883
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00575
Family F1F0 ATP synthase subunit C 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 440085.Mchl_3883
Sequence length 99
Comment (Methylobacterium chloromethanicum CM4)
Sequence
MQTKTIALAAALTLALSGAALAQTPAGGGSAEGNMNNPASVKSNSEKSMERATGSATGST
TGTGMAPAAPGAAGSTSGGSMGTGTGAGTSGAGGAAGGR
Download sequence
Identical sequences B7KXU3
WP_015951891.1.65134 440085.Mchl_3883 gi|218531807|ref|YP_002422623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]