SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441620.Mpop_4507 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441620.Mpop_4507
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-51
Family Ribonuclease PH domain 1-like 0.0000186
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.04e-49
Family Ribonuclease PH domain 1-like 0.00000898
Further Details:      
 
Domain Number 3 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.19e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-27
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 5 Region: 555-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.59e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 621-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.37e-20
Family Cold shock DNA-binding domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 441620.Mpop_4507
Sequence length 745
Comment (Methylobacterium populi BJ001)
Sequence
MFDVQREELIWGDRKLVLETGKTARQADGAVVATYGETTVLATVVAAKEPKAGIDFMPLT
VNYQERAYAAGRIPGGYFKREGRPSEKETLVSRLIDRPIRPLFVEGWRNDTQVVVTVLSH
DLENDPDIVSMVAASAALTLSGVPFMGPIGAARVGYLNGGYKLNPLVTEVAESTLDLVVA
GTQDAVLMVESEAKELSEDVMLGAVMFGHKHFQPVIEAIIRLAEKAAKEPRDFSPPENAD
VEKAVLDICESELRDAYKITVKQDRYKAVDAVKAKVVAALCPAEGEQKFSPEKVKAAFKE
AQSKVVRWNILDTGSRIDGRDVKTVRPIVSEVGVLPRAHGSSLFTRGETQALVVATLGTG
EDEQFIDALEGTYKERFLLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIRPVLPPAH
EFPYTIRVVSEITESNGSSSMASVCGGSLSLMDAGVPLRRPVAGIAMGLILEGERFAVLS
DILGDEDHLGDMDFKVAGTDEGITSLQMDIKIAGITEEIMRVALAQAKDGRAHILGEMAQ
ALTAARPELGEYAPRIETMQIPTDKIRDVIGTGGKIIREIVEKTGAKINIEDTGVVKIAS
SDGKAIKAAYNWIRSIVAEPEAGTIYDGTIVKIMEFGAFVNFFGAKDGLVHISELAPQRV
AKVGDVVKEGQKVKVKFLGADERGKIRLSMKVVDQETGEDITEKLKAERAERGEPEREER
SDRGDRGDRGPRRDRGERRRESSGE
Download sequence
Identical sequences A0A177IVR3 B1ZGS7
441620.Mpop_4507 WP_012456208.1.72001 WP_012456208.1.78039 gi|188583695|ref|YP_001927140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]