SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441770.CLB_1306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  441770.CLB_1306
Domain Number - Region: 34-79
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0451
Family Fibrinogen coiled-coil and central regions 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 441770.CLB_1306
Sequence length 157
Comment (Clostridium botulinum A ATCC 19397)
Sequence
MNKENKYFFSFCVGLVIGGTVGIIFFSLFISYRIENYHRKITYLNNIIEDQQVRLEGLEN
KLSKKKLIVKKIEVDIKFKNKEIEDELVAIELEKHIKEKFNNLIGKELDNLDGDILVQVV
DNRIMKIKNKQYKVKVEKIIIAQNIKFCIQVEKVQSD
Download sequence
Identical sequences A0A0M1L585 A5I1B5
gi|153934637|ref|YP_001387182.1| 413999.CBO1278 441770.CLB_1306 441771.CLC_1316 gi|148379259|ref|YP_001253800.1| gi|153933863|ref|YP_001383633.1| WP_011948899.1.10598 WP_011948899.1.21778 WP_011948899.1.25111 WP_011948899.1.27088 WP_011948899.1.28409 WP_011948899.1.34822 WP_011948899.1.46754 WP_011948899.1.57120 WP_011948899.1.63111 WP_011948899.1.63218 WP_011948899.1.65258 WP_011948899.1.73124 WP_011948899.1.75721 WP_011948899.1.92266 YP_001253800.1.75347 YP_001387182.1.17653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]