SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441772.CLI_1122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  441772.CLI_1122
Domain Number - Region: 29-71
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0109
Family Moesin tail domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 441772.CLI_1122
Sequence length 75
Comment (Clostridium botulinum F Langeland)
Sequence
MKNKPDDRKDNVDKIQYNITKTIQNCELADEMIAKTDDEKTKKTLIEKNERRREALDGMR
EEIKDEARDKKNGYM
Download sequence
Identical sequences A7GC78
441772.CLI_1122 gi|153939850|ref|YP_001390388.1| WP_011987946.1.24613 WP_011987946.1.68062 WP_011987946.1.82254 WP_011987946.1.96435 gi|384461459|ref|YP_005674054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]