SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441772.CLI_2459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441772.CLI_2459
Domain Number 1 Region: 310-466
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.24e-31
Family HD domain 0.021
Further Details:      
 
Domain Number 2 Region: 201-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.84e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 441772.CLI_2459
Sequence length 513
Comment (Clostridium botulinum F Langeland)
Sequence
MGPTKYIIIAVVIIIICVILGLYVVDKKAKEKLSEASKEARRLKEEAERDAEAKKKEAIL
EAKEEAHKLRAEVERENRERRNEVQRLERRIIQKEEALDKKSEALENKEEALNKKQQKIE
DVEAHMEELHEKQRTELERISGLTTEQAKEFLLEQVRKEVKHETAVMIKEIETKAKEEAD
KRAREVITYAIQRCAADHVAETTVHVVNLPNDEMKGRIIGREGRNIRTLETLTGVDLIID
DTPEAVILSGFDPIRREVARIALEKLIVDGRIHPARIEEMVEKAKKEVEVSIKEEGEQAT
FETGIHGLHIELIRLLGRLKYRTSYGQNVLKHSIEVSHLAGLMASELGIDPTLAKRVGLL
HDIGKAVDHEVEGPHAIIGSEIAKKYRESALVVNAIGAHHGDMEPQSLEAILVQAADAIS
AARPGARRETLEAYIKRLEKLEEIANECEGVEKSYAIQAGREIRIMVKPEVLDDTGCIEM
ARNIVKQIESELEYPGQIKVNVIRETRAIEYAK
Download sequence
Identical sequences A7GFZ1
WP_012100362.1.24613 WP_012100362.1.68062 WP_012100362.1.82254 WP_012100362.1.96435 gi|384462712|ref|YP_005675307.1| gi|153941348|ref|YP_001391701.1| 441772.CLI_2459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]