SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441772.CLI_2468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441772.CLI_2468
Domain Number 1 Region: 290-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-46
Family Ribonuclease PH domain 1-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-40
Family Ribonuclease PH domain 1-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 136-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-25
Family Ribonuclease PH domain 2-like 0.0033
Further Details:      
 
Domain Number 4 Region: 447-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.2e-25
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 609-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.48e-20
Family Cold shock DNA-binding domain-like 0.00047
Further Details:      
 
Domain Number 6 Region: 237-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.05e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 
Domain Number 7 Region: 551-629
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000026
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 441772.CLI_2468
Sequence length 702
Comment (Clostridium botulinum F Langeland)
Sequence
MIHTLETTVAGRKMKVDFGKTGMLSNAAIFMSYGDTVVMINANASKEPREGIDFFPLSVD
YEERLYSVGKIPGGFIKREGKPSDKSILHARSIDRPLRPLFPNGYRNDVQIVNTVLSVEQ
DNLPEILAINGSSLALCLSSIPFTTPVAAVSVGLVDGEFIINPTVAQRENTILDLTVCAT
KERIMMVEAGGQEIDEETMYNAILFGFEECKNIVAFQEEAVAKLGKTKDEQVLYKADEEV
EKEVKRFAFDMIKEAMYIMDKDERNAQLDKVKEKISEEFSQKYEDKGADIKEVIYKTQKE
IVRNMLLNEDRRPDGRAFDEVRPIGCEVGILPRTHGTGLFTRGLTQVMTVATLGALGDVQ
ILDGIAEEESKRYMHHYNFPSYSVGEVRPLRGPGRREIGHGALAERALEPLIPSQEEFPY
TIRLVSEVLSSNGSTSQASVCGSTLALLDAGVPIKRPAAGIAMGLITSDDLEREKVITDI
QGIEDFFGDMDFKVAGTEKGITSIQFDTKIKGLSNSCVKDALEGAKKARLHILGKIKECI
PEPRKELSKYAPRTEIICIDPEKIRDVIGAGGKVINKIIADTNVKIEIKEDGKIFVTSNN
EPEGVKKAISIIEGLTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARVE
KVEDVVSVGDEILVKVTDIDNQGRINLSRKDAIAKKEEEKDK
Download sequence
Identical sequences A7GG00
441772.CLI_2468 gi|153939959|ref|YP_001391710.1| WP_012100369.1.24613 WP_012100369.1.68062 WP_012100369.1.96435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]