SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 443144.GM21_2976 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  443144.GM21_2976
Domain Number 1 Region: 5-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-48
Family Ribonuclease PH domain 1-like 0.000023
Further Details:      
 
Domain Number 2 Region: 291-485
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-46
Family Ribonuclease PH domain 1-like 0.0000161
Further Details:      
 
Domain Number 3 Region: 447-542
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.13e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 136-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.66e-25
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 551-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 6 Region: 617-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.51e-20
Family Cold shock DNA-binding domain-like 0.00076
Further Details:      
 
Domain Number 7 Region: 236-318
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.39e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 443144.GM21_2976
Sequence length 696
Comment (Geobacter M21)
Sequence
MVHTVQAECCGKTITIETGKIAKQASGAVMIKSGDTMVLVTAVAMKSAKEGQGFFPLTVN
YQEKAYAGGRIPGSFFKREGRPSDNETLTCRLIDRPIRPLFPEGFLNDTQVMATVVSADK
DNDPAILSMIGASAALMVSDCPFAGPIAGVKVGRVNGAFIANPTAEELEKSDLEIVIAAS
QEAILMVEGSAAEVSENDLLEAIFFGHAAVQPILAAQLELAKKVGTPKRVILAPVVNEEL
KARVAALAKEGMKQAVRIKTKVERHLAIDAITAETVAALAAEFEGSEKEVKGFIEDLEYD
LVREHIIKDGQRIDGRDTKTIRAISTEVSLLPRAHGSALFTRGETQSIVAATLGTSVDEQ
RIDSLYGDSRKKFMLHYNFPPYSVGETSFRLAPGRREIGHGMLAERALQQVLPKHDDFPY
TIRIVSDITESNGSSSMATVCGGSLSMMDAGIPIKAPVAGIAMGLIKEGDDFAILSDILG
DEDHLGDMDFKVAGTAEGVTALQMDIKIGGVTREIMSAALAQAKAGRIHILGEMAKTIAA
SRGDLSAFAPRITTIWVKVDKIRDVIGSGGKNIRSVTEATGVSIDIDDTGKINIASTNKE
ACDLAIKMIRNLTAEAEEGKLYMGTVKKIMEFGAFVEIFPGTDGLVHVSELDTERVKNVS
DILKEGDKVLVKCIGIDKQGKIKLSRKEALGQTFTE
Download sequence
Identical sequences C6E2P5
gi|253701574|ref|YP_003022763.1| 443144.GM21_2976 WP_015838225.1.50895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]