SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 443906.CMM_0160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  443906.CMM_0160
Domain Number 1 Region: 37-227
Classification Level Classification E-value
Superfamily LigT-like 0.000000000549
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 443906.CMM_0160
Sequence length 242
Comment (Clavibacter michiganensis NCPPB 382)
Sequence
MDHDDPTAYALAAPDTAPASASRVEMRPSLLPRDDSDPYRYGIFLRPDARTCRAVTVVTD
QIRAQYGLVSAGAFPPHATLIGSQPFGHDEARVIEAVSELLADRPAFPVHNAGVREHGFG
FVYDVDGLPDGSQNAELLALAADIDRVAAPFRRPMDSPEHHSFDPARFRAHLSLASHDLL
VRPDLHDEVGAFIRELDEPVPTGFVGDTVVMYRTASPDWSGRWWTTLTWEHVRTWTLGGA
AL
Download sequence
Identical sequences A0A1Y3FCM5 A5CM95
443906.CMM_0160 gi|148271338|ref|YP_001220899.1| WP_011931379.1.100120 WP_011931379.1.36461 WP_011931379.1.80587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]