SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 444158.MmarC6_0356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444158.MmarC6_0356
Domain Number 1 Region: 35-217
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.18e-56
Family Endonuclease III 0.00087
Further Details:      
 
Weak hits

Sequence:  444158.MmarC6_0356
Domain Number - Region: 268-309
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.00418
Family GIY-YIG endonuclease 0.013
Further Details:      
 
Domain Number - Region: 222-339
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0419
Family Clostridium neurotoxins, "coiled-coil" domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 444158.MmarC6_0356
Sequence length 356
Comment (Methanococcus maripaludis C6)
Sequence
MNNTDIPFIKFLNILGENLKKDAVVDKISKNSNENERAFKILVSTVISARTKDETTAKVS
KELFKKVKSPKDLSEISVEELEKLVHPAGFYKTKAKNLKKLGEILLEKYDSKIPNSIEEL
IKLPGVGRKTANLVMTLAFDEYAICVDTHVHRITNRWNYVDTEFPENTEMELRKKLPKDY
WKRINNLLVVFGQEICSPIPKCDKCFSEIREICPHYNSLKELEKIYKDFNFKKTPKTKIP
KYKGTYVLRIKMNAPRTILVGKREIKFKKGDYFYIGSAMGDSMNLYNRISRHLSENKKKR
WHIDYLLEFSNVKEVNVTLGRFECDVSNRFNLVFDSVESFGCSDCKCKSHLYYIKP
Download sequence
Identical sequences A9A768
gi|159904747|ref|YP_001548409.1| WP_012193152.1.31524 444158.MmarC6_0356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]