SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 444177.Bsph_0530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444177.Bsph_0530
Domain Number 1 Region: 6-159
Classification Level Classification E-value
Superfamily PIN domain-like 1.65e-40
Family 5' to 3' exonuclease catalytic domain 0.00046
Further Details:      
 
Domain Number 2 Region: 177-279
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.15e-26
Family 5' to 3' exonuclease, C-terminal subdomain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 444177.Bsph_0530
Sequence length 296
Comment (Lysinibacillus sphaericus C3 41)
Sequence
MMTTVPKLLIVDGMALLFRSFFASAAMGHFIRLADGTPTNGAQGFVRHVLTAQSLMKPTH
MAVCWDMGAHTFRNELFDGYKANRPAPPEEMLPQFDMAKNLSLQMGWQNFGVKGMEADDL
IGSMIAKWQDDADITVISGDKDLLQLLRPSTEIAFMKKGYTEYDIYTHGRFKEEYSIEPA
QFAQVKAFMGDTSDGYPGVKGIGPKQALTLIQTYGSIDSVLASLGELKPGQRTKIQDQID
MLKLSHELATIQTDVPIEADLSSLVLPNYEPQIFKEMEESGYTLIAKHARSLYSLI
Download sequence
Identical sequences B1HWJ8
gi|169826127|ref|YP_001696285.1| 444177.Bsph_0530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]