SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 444179.SMGWSS_214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444179.SMGWSS_214
Domain Number 1 Region: 318-510
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-42
Family Ribonuclease PH domain 1-like 0.000047
Further Details:      
 
Domain Number 2 Region: 13-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.23e-39
Family Ribonuclease PH domain 1-like 0.0000709
Further Details:      
 
Domain Number 3 Region: 471-570
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.59e-19
Family Ribonuclease PH domain 2-like 0.00032
Further Details:      
 
Domain Number 4 Region: 147-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.06e-16
Family Ribonuclease PH domain 2-like 0.0051
Further Details:      
 
Domain Number 5 Region: 640-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000179
Family Cold shock DNA-binding domain-like 0.0039
Further Details:      
 
Domain Number 6 Region: 565-662
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000664
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 444179.SMGWSS_214
Sequence length 728
Comment (Candidatus Sulcia muelleri GWSS)
Sequence
MIPELIKENLFLEDGRALSIETGELARKANGSAVVRMGNTSLLATVVISKESKEDFKFIP
LTIDYREKYSAGGKIPGGYIKREGRPYDEEILTMRLVDRLLRPLFKDNYYNEIQIMISLL
SYDINVLPDGLAGLVASTAVSISEISFQGPVSTVRIIRINDAFIINPGIEEIKKSDFYLD
LDLDLDLIVGGTNNYIILVEGEMREISEIEMMEAIVKAHKYIQLQIEAQISLITKNKKFI
KKKLYKIELYNYYYKYINFNLNVFYIKEKIKFISYEEIDYIYKSCLFKQKRSNKIYNILK
KIKFHFYNESIVINNLEIDIIFDEIKKEIIKNILFKENIRLDGRSLDDIRNICSQVDCLP
GVHGSAIFTRGETQALSTVTLGSSLDVNKIDNAIMRAKQRFYLHYNFPPFSTGEIKLLKG
VSRREIGHGNLAQRALKNIIPTTYTIRVVSDVLESNGSSSMATVCASTLALMDSGIIVKR
PVSGISMGLIMNYLTGEAIILSDLLGDEDYIGDMDFKITGTEYGMTACQMDIKISGITYD
VLSYTIFKAKKGLLFIIKKMLTTLSCPRKSLNITATKIYTFYIPKKLIGAVIGSGGKRIQ
EIQVSTETNIKIKEKNYLGVIEILGKNETKLKIAILKIKNITFVPKVGTIYKAKVKNIKK
FGVFVKISKYLEGLLHIYEISWLTKVESFIRKGDIISVKYLGKNNKFRKIKLSHKMIFSR
YYLNKNLK
Download sequence
Identical sequences A8Z660
444179.SMGWSS_214 gi|161833811|ref|YP_001598007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]