SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 444450.ECH74115_2119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444450.ECH74115_2119
Domain Number 1 Region: 33-151
Classification Level Classification E-value
Superfamily PapD-like 3.14e-40
Family Pilus chaperone 0.00000423
Further Details:      
 
Domain Number 2 Region: 146-231
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.3e-21
Family Periplasmic chaperone C-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 444450.ECH74115_2119
Sequence length 236
Comment (Escherichia coli O157 H7 EC4115)
Sequence
MQTTRTPYSISFMATVLLLLLFACHSTVANAAVALGATRVIYPANQKQVLLPVTNNDPAS
VYLIQSWIENAGDQKDTQFVITPPLFSMQGKKENTLRIINATNHQLPGDRESLFWVNVKA
IPAMEKDQKNENTLQLAIISRIKMFYRPTNLAMAPEEAPAMLRFRRSGSNLTLINPTPYF
ITVTNMKAGNSNLPNTMVPPKGEVSVDIPHAATGDISFQTINDYGALTPRIKATMQ
Download sequence
Identical sequences A0A0F6C455 A0A0H3JF06 A0A0H3PKK9 A0A0K6EC02 A0A2H1BNQ3
gi|15831366|ref|NP_310139.1| 386585.ECs2112 444450.ECH74115_2119 544404.ECSP_1991 NP_310139.1.58667 gi|209399101|ref|YP_002270506.1| gi|387506718|ref|YP_006158974.1| gi|387882519|ref|YP_006312821.1| gi|254793052|ref|YP_003077889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]