SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 445985.BbuZS7_0515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  445985.BbuZS7_0515
Domain Number 1 Region: 304-461
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.24e-28
Family HD domain 0.016
Further Details:      
 
Domain Number 2 Region: 188-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.59e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 445985.BbuZS7_0515
Sequence length 510
Comment (Borrelia burgdorferi ZS7)
Sequence
MIYIIFSSIFAGFILGFLVRVFLGRLSLLDLEKNLKKVRVESQLEIENERRQIIANAKSQ
MLKEKNQQDRDIRDRKNEIVNLEKRLLQREETLDKRISALDKQQSRVDFKIKEFEQKEKV
IREKEADLVKRLENISGLTREDARKIVIEKVEHESKRDAQVIINKSEQEAQLLADKVAKD
ILVSTMQRIVTEVSSEFTVASVELPNDEMKGRIIGKEGRNIRALETLIGADIIIDDTPEA
VVISCFDPIRKELAKRTLERLVTDGRIHPARIEEVVYNVTNEINSIIQEEGEKVVFDLNI
HGLDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEILAKEMKLDPVVVKRACLLHDIGK
GMESISDNSEGHAITGAELAQSCGESEIVVNAIAAHHNEVKPESLEAIVVQIADAISASR
PGARRESLNNYINRLKRLEDIAYSFEGVQKCYAIQAGREVRIIVDNALINDEKSILLARD
IAKKIEAEMRYPRKIKVTIIRETRVIEYAR
Download sequence
Identical sequences A0A0H3C275
gi|218249378|ref|YP_002375014.1| 445985.BbuZS7_0515 WP_012597332.1.96757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]