SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0183814 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDBDRAFT_0183814
Domain Number 1 Region: 231-364
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.21e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.00043
Further Details:      
 
Domain Number 2 Region: 137-229
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.14e-24
Family Cold shock DNA-binding domain-like 0.0000449
Further Details:      
 
Domain Number 3 Region: 87-134
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000157
Family ECR1 N-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0183814
Sequence length 380
Comment (Dictyostelium discoideum)
Sequence
MENNNNNNNNNNLNNISIEIFSPQKRLPLKHTISQTTKNDNKIKKESNLKSEQNDKDMLN
VDEIKQEDGVDGDDDDEMDNELFQSKKLVITGQTISREGEYLKGHGTFNDGSGSLVASVC
GTLDKVDRLVSVKALKSRYHGEVGDIIVGRITEITSKRWKVDVNSRLDYILMLSAINLPG
GIQRRRTSADELQMRSFFVENDLVYAEVQMVMGDGSVAIHTRNQKYGKLQNGHFTKVIPS
LIKRSKQHFYNLECGVDVILGVNGYIWIADSEQQKNQQQFIQKHEKEPTFDPSIPLIIPD
EIKQVSKESRDRIARVKNSISLLEKGFLLIHQKSIMNVYKLSLKMKLQSKDLLHPQYIKQ
ILTVLSTTDYDNDDNNENDQ
Download sequence
Identical sequences Q54EV5
DDB0308172|DDB_G0291310 XP_635135.1.73096 44689.DDBDRAFT_0183814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]