SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0187530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDBDRAFT_0187530
Domain Number 1 Region: 144-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0187530
Sequence length 239
Comment (Dictyostelium discoideum)
Sequence
MTEVIETKEVENIISEQSLKTESVKVSNKRSRDDEEMKDSEGGVKKTSFPQISVEDTEEE
QIRKVTIPFNRIAPLKANWQQIYEPIVTHLKLQIRMNTKTRKVELKTSKSTKETSALQKA
ADFVHAFSLGFEVNDAVAILRLDDLYIDSFDVEDVKILKGDNLSRAIGRVAGKDGKTKFT
IENVTKTRIVLADKRIHILGSYSNIRVAKDAICDLIIGSPPGKVYAKLRTVSSRIAERF
Download sequence
Identical sequences Q54K66
DDB0266405|DDB_G0287557 44689.DDBDRAFT_0187530 XP_637189.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]