SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0188688 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDBDRAFT_0188688
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily UBA-like 0.00000015
Family TAP-C domain-like 0.022
Further Details:      
 
Weak hits

Sequence:  44689.DDBDRAFT_0188688
Domain Number - Region: 101-246
Classification Level Classification E-value
Superfamily EF-hand 0.000158
Family S100 proteins 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0188688
Sequence length 249
Comment (Dictyostelium discoideum)
Sequence
MYRLPADQKLKCTEFMSITEATEAKAIQYLKDASWRTDAAVDNFYSNPSNFANKFDKKAI
ETIFNKYKDSGEEQISEKLPEFVKDININDEMMELAVLWKFKTKQMGVITKNEFMETMER
LRCDNISSLEKQMETVRQQLSSKDLNNNSAFKEFYMFVFDLGKAENQKNVSLQMCIELWT
IVLKSKFDNLQIWFDFLNKHHKLAISKDTWNLFLDFVKIANDSITKYDSEGAWPVLIDEF
VEYYKENCK
Download sequence
Identical sequences Q54GP1
DDB0305617|DDB_G0290025 44689.DDBDRAFT_0188688 XP_635921.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]