SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0190755 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  44689.DDBDRAFT_0190755
Domain Number - Region: 7-96
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000314
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 
Domain Number - Region: 81-118
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.0706
Family Hect, E3 ligase catalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0190755
Sequence length 255
Comment (Dictyostelium discoideum)
Sequence
MGVPEEYQQIPINQPQQQPQQQPQQPQQQQQQQYHPQQPPQQPSSSPVQQLLNQNYDVNS
YTPSIVKTQQYKLAYEKGHFNFMNGFSKIYPNELNNILTPNEYNDLVIELNDICQQDPRK
LILAIVIGVILIIVVPFSIVLSLILIPLAILLFYKRMDAKMQKVIEKYNCSLITRGIYIN
IAKRIERRDVLINYPIELAYSLQPQQQPQVPLYVPQPYPQQQPQQQQQQPQMMVFSQQPM
NNAVVGDNITLLDKY
Download sequence
Identical sequences Q55CJ4
DDB0307706|DDB_G0270034 44689.DDBDRAFT_0190755 XP_646487.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]