SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0190886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDBDRAFT_0190886
Domain Number 1 Region: 440-821
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.25e-91
Family Ankyrin repeat 0.00000279
Further Details:      
 
Domain Number 2 Region: 29-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-34
Family Calponin-homology domain, CH-domain 0.00048
Further Details:      
 
Domain Number 3 Region: 364-477
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.56e-24
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0190886
Sequence length 839
Comment (Dictyostelium discoideum)
Sequence
MSTNNLGRPVRPTGSKKTGGASSVTITMSDFQTYEMQARQVECKLWIESIIDEEIDNDLH
QALKDGVVLCKLANTMFPAIITRYNKQSSITFKLLENINSFLQVAKKMGISDNQLFIATD
LWENKNFQMVISTINKMATIAVSKGFPIKWPTVDDPNKETKFEKASPDRVLEWDNSFIYS
NNSSNSNNGNNSPKSPASTIGKKTTSFGTPTTSRNSINFSLPPKLTASSTSTSNLIQTNS
NPTTPTTSTTSTPNLSSTVTITTTTPTTTPTPTPTKPITPLVVTPPATVVSPLSPISLVS
TPPPPTTTTIVVKENENEKEKEQLPPPQSQSQPQPKIEKENENEKIKTNLETEILIKKEL
TKQDKIEIIINQYKELSIKENNGNESIHYAVRDGNIEVIKSIANSDNVNSKNQNTGRTPL
HVGVLNGNVEIVEILLEIEGCDCNQADTDGNTPIHLAVLKGNHSMVETLIKKGTQTNTNA
VNRDGSTPMMMVSVNGDERMVDLLLEGGADVNSSNKKGNTALHYATLKGHKKVVDKLLEA
GSDVNAVNQDGATSLHVAAEENFPNIIESLANSGAVVDQQRLDGWTPLYSAAFKGNRETA
ISLLSKGASVDSHNLEGWTPLHSACSEGHLKMAQLLITTYKSDVNSQNFQGTTSLFHACS
SGHLELVKYLFQVGSNPELSRPGGWKPIHIACYNENDLITRYLIEKNVNLNCTNSEIKGY
APIHILISTEEPRLEIIELLLSKKINVNIKNVNGSTPLHLAVFWNHFKVLELLLKYGASL
EEKNNKGRTPLSLACHYGNEIIAKYLAEKTNKDVKKLKIKNNKQKILDMEIPDSPPVPL
Download sequence
Identical sequences Q55C56
44689.DDBDRAFT_0190886 XP_646625.1.73096 DDB0306623|DDB_G0270220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]