SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0216791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  44689.DDBDRAFT_0216791
Domain Number - Region: 156-186
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.062
Family CCCH zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0216791
Sequence length 189
Comment (Dictyostelium discoideum)
Sequence
MNEMKYEATCTFHPIPNRQLLSEIACLNKPLGVELKFWKKLPLIELKIDGLQFSHLVNND
LTQLKHLKLYSCPSSLHASTLQPGALISLNKRCPTLKTLAIQVPFHLINKHYHGCKITKQ
CFNGDNLSKNISKEWNELIVTLSNNTSIVNLTISNFPCEYFLDPIKCYQYSNLEFNENTI
KYDKNNLNI
Download sequence
Identical sequences Q55BG5
XP_645647.1.73096 DDB0216791|DDB_G0271364 44689.DDBDRAFT_0216791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]