SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0218412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDBDRAFT_0218412
Domain Number 1 Region: 11-49
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000706
Family HIT zinc finger 0.039
Further Details:      
 
Weak hits

Sequence:  44689.DDBDRAFT_0218412
Domain Number - Region: 170-217
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0491
Family BCR-homology GTPase activation domain (BH-domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0218412
Sequence length 236
Comment (Dictyostelium discoideum)
Sequence
MENNLTIKNPNPLCSICNIKKFIYSCPKCKNIKYCSLICFSKHKELVNNHETPIEININK
EENKKDDTILDNDIKMNEPKLSTSEIELKSSSDSSSPSSENEDEEEGDEEEEEEEEEEEE
SGEESEDEKVKIRKEPIDNSKVSRFSESLNYFKKVTDEQFQKLDNSKYINSVITVKSLQQ
LIIEIDQQPSDQDKIQLLQQYRKKLPEFNEFILKVLATIGCLDSLTIDENDNLIKK
Download sequence
Identical sequences Q54RW0
XP_639377.1.73096 DDB0218412|DDB_G0282901 44689.DDBDRAFT_0218412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]